Menu

  • 10% off first order with code: 1storder
  • Buy 5 get 5% Discount
  • Buy 10 get 10% Discount
  • Spend £200 & get FREE Delivery
  • Pay by crypto get 10% discount
AOD-9604

FOX04-DRI Nasal Spray

£205.99£405.98

Sequence: H-LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG-OH
Molar mass: 5358.05
Formula: C228H388N86O64

25ml Contains FOXO4-DRI 20mg
15ml Contains FOXO4-DRI 10mg

Clear
SKU: FOX04-DRI Nasal Spray Category:

Description

FOX04-DRI Nasal Spray

Sequence: H-LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG-OH
Molar mass: 5358.05
Formula: C228H388N86O64

Disclaimer: All products provided by High-Grade Labs and or listed on this website are intended for medical research purposes only.
No product supplied by High-Grade Labs is intended for human consumption or to be used as a drug, stimulant or supplement.

 

AOD-9604
Select Your currency
GBP Pound sterling
EUR Euro