FOX04-DRI Nasal Spray

£205.99£405.98

Sequence: H-LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG-OH
Molar mass: 5358.05
Formula: C228H388N86O64

25ml Contains FOXO4-DRI 20mg
15ml Contains FOXO4-DRI 10mg

Clear
SKU FOX04-DRI Nasal Spray Categories ,

Description

FOX04-DRI Nasal Spray

Sequence: H-LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG-OH
Molar mass: 5358.05
Formula: C228H388N86O64

Disclaimer: All products provided by High-Grade Labs and or listed on this website are intended for medical research purposes only.
No product supplied by High-Grade Labs is intended for human consumption or to be used as a drug, stimulant or supplement.

 

Additional information

Weight0.1 kg
Dimensions1 × 1 × 1 cm
Size

15ml, 25ml

You may also like…