FOX04-DRI

£194.99

10mg Vial

Sequence: H-LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG-OH
Molar mass: 5358.05
Formula: C228H388N86O64

996 in stock

SKU FOX04-DRI Pepide Vial Categories ,

Description

FOX04-DRI Pepide Vial

Sequence: H-LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG-OH
Molar mass: 5358.05
Formula: C228H388N86O64

Disclaimer: All products provided by High Grade Labs and or listed on this website are intended for medical research purposes only.
No product supplied by High Grade Labs is intended for human consumption or to be used as a drug, stimulant or supplement.

Additional information

Weight0.1 kg
Dimensions1 × 1 × 1 cm
Size

2mg

You may also like…