Menu

  • 10% off first order with code: 1storder
  • Buy 5 get 5% Discount
  • Buy 10 get 10% Discount
  • Spend £200 & get FREE Delivery
  • Pay by crypto get 10% discount

FOX04-DRI

£194.99

10mg Vial

Sequence: H-LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG-OH
Molar mass: 5358.05
Formula: C228H388N86O64

996 in stock

SKU: FOX04-DRI Pepide Vial Category:

Description

FOX04-DRI Pepide Vial

Sequence: H-LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG-OH
Molar mass: 5358.05
Formula: C228H388N86O64

Disclaimer: All products provided by High Grade Labs and or listed on this website are intended for medical research purposes only.
No product supplied by High Grade Labs is intended for human consumption or to be used as a drug, stimulant or supplement.

Select Your currency
GBP Pound sterling
EUR Euro