Menu
£204.44 – £211.14
FOXO4-DRI is the most potent senolytic currently under investigation. It can help seniors live longer and even lessen the effects of dementia if given to them.
10mg Vial
Sequence: H-LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG-OH
Molar mass: 5358.05
Formula: C228H388N86O64
To stop the p53 gene from communicating with other genes, Foxo4dri works by triggering cell death in senescent cells. If further research can prove that this peptide reduces the creation of senescent cells, it could lead to a longer and healthier life.
More of your cells enter a senescent state as you age, meaning they no longer divide or support the tissues to which they belong. For example, neighbouring cells become senescent due to the toxic chemical signals emitted by these ageing cells.
Because of this, tissues function degrades, inflammation is elevated, and cancer risk goes up.
FOXO4 DRI has been shown in studies to decrease the level of these harmful cells. In addition, the FOXO4 hormone peptide can find and destroy cancerous cells when given in sufficient quantities.
Sequence: H-LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG-OH
Molar mass: 5358.05
Formula: C228H388N86O64
Storage: 4˚C or below for a period of up to 3 months.
Disclaimer: All products provided by High Grade Labs and or listed on this website are intended for medical research purposes only.
No product supplied by High Grade Labs is intended for human consumption or to be used as a drug, stimulant or supplement.
| Weight | 0.1 kg |
|---|---|
| Dimensions | 1 × 1 × 1 cm |
| Size | 10mg vial, Kit 10mg vial, bac water & needles |
