KISSPEPTIN

£18.99

5mg peptide vial

994 in stock

SKU KISSPEPTIN Pepide Vial Categories ,

Description

KISSPEPTIN 5mg Pepide Vial

Molecular Formula: C258H401N79O78
Molecular Weight: 5857 g/mol
Sequence: GTSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRF
Physical Appearance: White Lyophilised Solid
Form: Sterile Filtered White Lyophilized
Solubility: Water Soluble

Storage: Peptides should be refrigerated at 4˚C or below for a period of up to 3 months. To prolong the life span of the peptides they may be placed in a freezer for up to 12 months. Once reconstituted peptides should be refrigerated/stored at 4˚C for up to 30 days.

Disclaimer: All products provided by High-Grade Labs and or listed on this website are intended for medical research purposes only. No product supplied by High-Grade Labs is intended for human consumption or to be used as a drug, stimulant or supplement.

Additional information

Weight0.1 kg
Dimensions1 × 1 × 1 cm
Size

5mg

You may also like…