Menu
£18.99 – £25.39
Kisspeptin regulates the release of reproductive hormones by controlling the amount of kisspeptin secreted. Kisspeptin could affect testosterone levels and sex-related behaviours such as drive and motivation during a sexual encounter. Research suggests it could help slow or even reverse the ageing process.
5mg peptide vial
A naturally occurring human protein known as kisspeptin (also known as metastin) helps regulate hormone signalling throughout puberty and reproduction. As a result, mood and behaviour are also altered, angiogenesis is boosted, and the kidneys are better controlled. In addition, researchers have discovered this peptide in the brain, which acts to slow tumour progression (spread). The peptide’s potential to manipulate gonadotropin-releasing hormone is of particular scientific interest (GnRH).
Benefits of Kisspeptin include:
Molecular Formula: C258H401N79O78
Molecular Weight: 5857 g/mol
Sequence: GTSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRF
Physical Appearance: White Lyophilised Solid
Form: Sterile Filtered White Lyophilized
Solubility: Water Soluble
Storage: 4˚C or below for a period of up to 3 months.
Disclaimer: All products provided by High-Grade Labs and or listed on this website are intended for medical research purposes only. No product supplied by High-Grade Labs is intended for human consumption or to be used as a drug, stimulant or supplement.
| Weight | 0.1 kg |
|---|---|
| Dimensions | 1 × 1 × 1 cm |
| Size | 5mg vial, Kit_5mg vial, bac water & needles |
